Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Folate receptor beta(FOLR2),partial

Recombinant Human Folate receptor beta(FOLR2),partial

SKU:CSB-BP008786HU1

Regular price €519,95 EUR
Regular price Sale price €519,95 EUR
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 20ug

Updated Date: Stock Protein updated on 20171228

Research areas: Metabolism

Target / Protein: FOLR2

Biologically active: Not Tested

Expression system: Baculovirus

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: P14207

AA Sequence: CSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVN

Tag info: N-terminal 10xHis-tagged

Expression Region: 19-230aa

Protein length: Partial

MW: 27.1 kDa

Alternative Name(s): Folate receptor 2 Folate receptor, fetal/placental Placental folate-binding protein

Relevance: Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release.

Reference: "Folate coenzyme and antifolate transport proteins in normal and neoplastic cells." Freisheim J.H., Price E.M., Ratnam M. Adv. Enzyme Regul. 29:13-26(1989)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details