Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human E3 ubiquitin-protein ligase MARCH8(41341)

Recombinant Human E3 ubiquitin-protein ligase MARCH8(41341)

SKU:CSB-CF722561HU

Regular price €1.575,95 EUR
Regular price Sale price €1.575,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q5T0T0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNISKAGSPPSASA PAPVSSFSRTSITPSSQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDT RCCELCKYEFIMETKLKPLRKWEKLQMTSSERRKIMCSVTFHVIAITCVVWSLYVLIDRT AEEIKQGQATGILEWPFWTKLVVVAIGFTGGLLFMYVQCKVYVQLWKRLKAYNRVIYVQN CPETSKKNIFEKSPLTEPNFENKHGYGICHSDTNSSCCTEPEDTGAEIIHV

Protein Names:Recommended name: E3 ubiquitin-protein ligase MARCH8 EC= 6.3.2.- Alternative name(s): Cellular modulator of immune recognition Short name= c-MIR Membrane-associated RING finger protein 8 Membrane-associated RING-CH protein VI

Gene Names:Name:MARCH8 Synonyms:MIR, RNF178

Expression Region:1-291

Sequence Info:full length protein

View full details