Gene Bio Systems
Recombinant Human Dual specificity protein phosphatase 26(DUSP26)
Recombinant Human Dual specificity protein phosphatase 26(DUSP26)
SKU:CSB-EP863128HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Signal Transduction
Uniprot ID: Q9BV47
Gene Names: DUSP26
Organism: Homo sapiens (Human)
AA Sequence: MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLEA
Expression Region: 1-211aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 39.9 kDa
Alternative Name(s): Dual specificity phosphatase SKRP3Low-molecular-mass dual-specificity phosphatase 4 ;DSP-4 ;LDP-4Mitogen-activated protein kinase phosphatase 8 ;MAP kinase phosphatase 8 ;MKP-8Novel amplified gene in thyroid anaplastic cancer
Relevance: Inactivates MAPK1 and MAPK3 which leads to dephosphorylation of heat shock factor protein 4 and a reduction in its DNA-binding activity. Inhibits MAP kinase p38 by dephosphorylating it and inhibits p38-mediated apoptosis in anaplastic thyroid cancer cells. Can also induce activation of MAP kinase p38 and c-Jun N-terminal kinase (JNK).
Reference: MKP-8, a novel MAPK phosphatase that inhibits p38 kinase.Vasudevan S.A., Skoko J., Wang K., Burlingame S.M., Patel P.N., Lazo J.S., Nuchtern J.G., Yang J.Biochem. Biophys. Res. Commun. 330:511-518(2005)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
