Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Dual specificity protein phosphatase 26(DUSP26)

Recombinant Human Dual specificity protein phosphatase 26(DUSP26)

SKU:CSB-EP863128HU

Regular price €676,95 EUR
Regular price Sale price €676,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: Q9BV47

Gene Names: DUSP26

Organism: Homo sapiens (Human)

AA Sequence: MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLEA

Expression Region: 1-211aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 39.9 kDa

Alternative Name(s): Dual specificity phosphatase SKRP3Low-molecular-mass dual-specificity phosphatase 4 ;DSP-4 ;LDP-4Mitogen-activated protein kinase phosphatase 8 ;MAP kinase phosphatase 8 ;MKP-8Novel amplified gene in thyroid anaplastic cancer

Relevance: Inactivates MAPK1 and MAPK3 which leads to dephosphorylation of heat shock factor protein 4 and a reduction in its DNA-binding activity. Inhibits MAP kinase p38 by dephosphorylating it and inhibits p38-mediated apoptosis in anaplastic thyroid cancer cells. Can also induce activation of MAP kinase p38 and c-Jun N-terminal kinase (JNK).

Reference: MKP-8, a novel MAPK phosphatase that inhibits p38 kinase.Vasudevan S.A., Skoko J., Wang K., Burlingame S.M., Patel P.N., Lazo J.S., Nuchtern J.G., Yang J.Biochem. Biophys. Res. Commun. 330:511-518(2005)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details