Gene Bio Systems
Recombinant Human Dolichol phosphate-mannose biosynthesis regulatory protein(DPM2)
Recombinant Human Dolichol phosphate-mannose biosynthesis regulatory protein(DPM2)
SKU:CSB-CF007135HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:O94777
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLLL LLFVGLFISYVMLKTKRVTKKAQ
Protein Names:Recommended name: Dolichol phosphate-mannose biosynthesis regulatory protein
Gene Names:Name:DPM2 ORF Names:My026
Expression Region:2-84
Sequence Info:Full length protein
