Recombinant Human DNA fragmentation factor subunit alpha(DFFA)

SKU: CSB-EP006737HU

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cell Biology

Uniprot ID: O00273

Gene Names: DFFA

Organism: Homo sapiens (Human)

AA Sequence: MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACEWELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT

Expression Region: 1-331aa

Sequence Info: Full Length of BC007721

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 63.6 kDa

Alternative Name(s): DNA fragmentation factor 45KDA subunit

Relevance: Inhibitor of the caspase-activated DNase (DFF40).

Reference: "DFF, a heterodimeric protein that functions downstream of caspase-3 to trigger DNA fragmentation during apoptosis." Liu X., Zou H., Slaughter C., Wang X. Cell 89:175-184(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.