Gene Bio Systems
Recombinant Human DNA-binding protein inhibitor ID-1(ID1)
Recombinant Human DNA-binding protein inhibitor ID-1(ID1)
SKU:CSB-EP010966HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cancer
Uniprot ID: P41134
Gene Names: ID1
Organism: Homo sapiens (Human)
AA Sequence: MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
Expression Region: 1-155aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 32.1 kDa
Alternative Name(s): Class B basic helix-loop-helix protein 24 ;bHLHb24Inhibitor of DNA binding 1Inhibitor of differentiation 1
Relevance: Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer .
Reference: Nucleotide sequence of the cDNA encoding human helix-loop-helix Id-1 protein identification of functionally conserved residues common to Id proteins.Deed R.W., Jasiok M., Norton J.D.Biochim. Biophys. Acta 1219:160-162(1994)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
