Gene Bio Systems
Recombinant Human Death-associated protein 1(DAP)
Recombinant Human Death-associated protein 1(DAP)
SKU:CSB-RP010344h
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Apoptosis
Uniprot ID: P51397
Gene Names: DAP1
Organism: Homo sapiens (Human)
AA Sequence: SSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK
Expression Region: 2-102aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 38 kDa
Alternative Name(s):
Relevance: Negative regulator of autophagy. Involved in mediating interferon-gamma-induced cell death.
Reference: Identification of a novel serine/threonine kinase and a novel 15-kD protein as potential mediators of the gamma interferon-induced cell death.Deiss L.P., Feinstein E., Berissi H., Cohen O., Kimchi A.Genes Dev. 9:15-30(1995)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
