Recombinant Human D-amino acid oxidase activator(DAOA)

Recombinant Human D-amino acid oxidase activator(DAOA)

CSB-EP006495HU
Regular price
€490,95 EUR
Sale price
€490,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P59103

Gene Names: DAOA

Organism: Homo sapiens (Human)

AA Sequence: MLEKLMGADSLQLFRSRYTLGKIYFIGFQRSILLSKSENSLNSIAKETEEGRETVTRKEGWKRRHEDGYLEMAQRHLQRSLCPWVSYLPQPYAELEEVSSHVGKVFMARNYEFLAYEASKDRRQPLERMWTCNYNQQKDQSCNHKEITSTKAE

Expression Region: 1-153aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 45.1 kDa

Alternative Name(s): Protein G72

Relevance: Ses to activate D-amino acid oxidase.

Reference: An unappreciated role for RNA surveillance.Hillman R.T., Green R.E., Brenner S.E.Genome Biol. 5:R8.1-R8.16(2004)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share