Gene Bio Systems
Recombinant Human Cytochrome c oxidase subunit 7A-related protein, mitochondrial(COX7A2L)
Recombinant Human Cytochrome c oxidase subunit 7A-related protein, mitochondrial(COX7A2L)
SKU:CSB-EP005862HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Signal Transduction
Uniprot ID: O14548
Gene Names: COX7A2L
Organism: Homo sapiens (Human)
AA Sequence: MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK
Expression Region: 1-114aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 39.6 kDa
Alternative Name(s): COX7a-related protein Cytochrome c oxidase subunit VIIa-related protein EB1
Relevance: Involved in the regulation of oxidative phosphorylation and energy metabolism. Necessary for the assembly of mitochondrial respiratory supercomplex
Reference: "Isolation of estrogen-responsive genes with a CpG island library." Watanabe T., Inoue S., Hiroi H., Orimo A., Kawashima H., Muramatsu M. Mol. Cell. Biol. 18:442-449(1998)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.