Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Claudin-3(CLDN3),partial

Recombinant Human Claudin-3(CLDN3),partial

SKU:CSB-EP005505HU1a6

Regular price €769,95 EUR
Regular price Sale price €769,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Signal Transduction

Uniprot ID: O15551

Gene Names: CLDN3

Organism: Homo sapiens (Human)

AA Sequence: RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR

Expression Region: 30-80aa

Sequence Info: Extracellular Domain

Source: E.coli

Tag Info: N-terminal 6xHis-B2M-tagged

MW: 19.7 kDa

Alternative Name(s): Clostridium perfringens enterotoxin receptor 2

Relevance: Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.

Reference: "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome." Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H. J. Proteomics 96:253-262(2014)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details