Gene Bio Systems
Recombinant Human CD83 antigen(CD83)
Recombinant Human CD83 antigen(CD83)
SKU:CSB-CF004962HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q01151
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV
Protein Names:Recommended name: CD83 antigen Short name= hCD83 Alternative name(s): B-cell activation protein Cell surface protein HB15 CD_antigen= CD83
Gene Names:Name:CD83
Expression Region:20-205
Sequence Info:full length protein
