Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Cathepsin K(CTSK)

Recombinant Human Cathepsin K(CTSK)

SKU:CSB-EP006192HU

Regular price €677,95 EUR
Regular price Sale price €677,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: P43235

Gene Names: CTSK

Organism: Homo sapiens (Human)

AA Sequence: APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM

Expression Region: 115-329aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 27.5 kDa

Alternative Name(s): Cathepsin OCathepsin O2;Cathepsin X

Relevance: Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone rodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in Extracellular domain matrix degradation.

Reference: Cathepsin K gene mutations and 1q21 haplotypes in at patients with pycnodysostosis in an outbred population.Haagerup A., Hertz J.M., Christensen M.F., Binderup H., Kruse T.A.Eur. J. Hum. Genet. 8:431-436(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details