Recombinant Human Caspase-7(CASP7),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Caspase-7(CASP7),partial

CSB-RP154794h(A4)
Regular price
€611,95 EUR
Sale price
€611,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Apoptosis

Uniprot ID: P55210

Gene Names: CASP7

Organism: Homo sapiens (Human)

AA Sequence: ANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ

Expression Region: 207-303aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 15.3 kDa

Alternative Name(s): Apoptotic protease Mch-3CMH-1ICE-like apoptotic protease 3 ;ICE-LAP3

Relevance: Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves and activates sterol regulatory elent binding proteins (SREBPs). Proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Overexpression promotes programmed cell death.

Reference: Mch3, a novel human apoptotic cysteine protease highly related to CPP32.Fernandes-Alnemri T., Takahashi A., Armstrong R.C., Krebs J., Fritz L.C., Tomaselli K.J., Wang L., Yu Z., Croce C.M., Salveson G., Earnshaw W.C., Litwack G., Alnemri E.S.Cancer Res. 55:6045-6052(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Caspase-7(CASP7),partial
    Regular price
    €611,95 EUR
    Sale price
    €611,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Caspase-3(CASP3),partial
    Regular price
    €611,95 EUR
    Sale price
    €611,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Caspase-3(CASP3),partial
    Regular price
    €611,95 EUR
    Sale price
    €611,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • CASP3 antibody , Cat. # FNab09938
    Regular price
    €398,95 EUR
    Sale price
    €398,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share