Gene Bio Systems
Recombinant Human Calcitonin gene-related peptide 2(CALCB)
Recombinant Human Calcitonin gene-related peptide 2(CALCB)
SKU:CSB-EP004435HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Neuroscience
Uniprot ID: P10092
Gene Names: CALCB
Organism: Homo sapiens (Human)
AA Sequence: MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA
Expression Region: 1-127aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 40.7 kDa
Alternative Name(s): Beta-type CGRP
Relevance: CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role.
Reference: "Structure and expression of the human calcitonin/CGRP genes." Steenbergh P.H., Hoeppener J.W.M., Zandberg J., Visser A., Lips C.J.M., Jansz H.S. FEBS Lett. 209:97-103(1986)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.