
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Immunology
Uniprot ID: Q07325
Gene Names: CXCL9
Organism: Homo sapiens (Human)
AA Sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Expression Region: 23-125aa
Sequence Info: Full Length of Mature Protein
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW: 16.7 kDa
Alternative Name(s): Gamma-interferon-induced monokine Monokine induced by interferon-gamma CMK, MIG, SCYB9
Relevance: Cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. Chemotactic for activated T-cells. Binds to CXCR3.
Reference: "Human IP-9: a keratinocyte derived high affinity CXC-chemokine ligand for the IP-10/Mig receptor (CXCR3)." Tensen C.P., Flier J., van der Raaij-Helmer E.M.H., Sampat-Sardjoepersad S., van der Schors R.C., Leurs R., Scheper R.J., Boorsma D.M., Willemze R. J. Invest. Dermatol. 112:716-722(1999)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human C-X-C motif chemokine 10(CXCL10)
- Regular price
- €612,95 EUR
- Sale price
- €612,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human C-X-C motif chemokine 10(CXCL10)
- Regular price
- €684,95 EUR
- Sale price
- €684,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse C-X-C motif chemokine 9(Cxcl9)
- Regular price
- €783,95 EUR
- Sale price
- €783,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human C-X-C motif chemokine 10 protein(CXCL10)
- Regular price
- €612,95 EUR
- Sale price
- €612,95 EUR
- Regular price
-
- Unit price
- per
Sold out