Gene Bio Systems
Recombinant Human C-type lectin domain family 4 member C (CLEC4C) ,partial
Recombinant Human C-type lectin domain family 4 member C (CLEC4C) ,partial
SKU:CSB-MP855470HU
Couldn't load pickup availability
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 20ug
Updated Date: Stock Protein updated on 20170405
Research areas: Immunology
Target / Protein: CLEC4C
Biologically active: Not Tested
Expression system: Mammalian cell
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: Q8WTT0
AA Sequence: NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
Tag info: N-terminal 6xHis-tagged
Expression Region: 45-213aa
Protein length: Extracellular Domain
MW: 24 kDa
Alternative Name(s): Blood dendritic cell antigen 2 Short name: BDCA-2 C-type lectin superfamily member 7 Dendritic lectin CD_antigen: CD303
Relevance: Involved in antigen-capturing. Target ligand into antigen processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium. Does not seem to bind mannose.
Reference: "Molecular and genomic characterization of human DLEC, a novel member of the C-type lectin receptor gene family preferentially expressed on monocyte-derived dendritic cells."Arce I., Roda-Navarro P., Montoya M.C., Hernanz-Falcon P., Puig-Kroger A., Fernandez-Ruiz E.Eur. J. Immunol. 31:2733-2740(2001)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
