Gene Bio Systems
Recombinant Human Bcl-2-interacting killer(BIK)
Recombinant Human Bcl-2-interacting killer(BIK)
SKU:CSB-CF615677HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q13323
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALR LACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMR FWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK
Protein Names:Recommended name: Bcl-2-interacting killer Alternative name(s): Apoptosis inducer NBK BIP1 BP4
Gene Names:Name:BIK Synonyms:NBK
Expression Region:1-160
Sequence Info:full length protein
