Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Bax inhibitor 1(TMBIM6)

Recombinant Human Bax inhibitor 1(TMBIM6)

SKU:CSB-CF023632HU

Regular price €1.521,95 EUR
Regular price Sale price €1.521,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P55061

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLS ALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMG TAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVV MCGFVLFDTQLIIEKAEHGDQDYIWHCIDLFLDFITVFRKLMMILAMNEKDKKKEKK

Protein Names:Recommended name: Bax inhibitor 1 Short name= BI-1 Alternative name(s): Testis-enhanced gene transcript protein Transmembrane BAX inhibitor motif-containing protein 6

Gene Names:Name:TMBIM6 Synonyms:BI1, TEGT

Expression Region:1-237

Sequence Info:Full length protein

View full details