Skip to product information
1 of 1

GeneBio Systems

Recombinant Human B- and T-lymphocyte attenuator (BTLA), partial (Active)

Recombinant Human B- and T-lymphocyte attenuator (BTLA), partial (Active)

SKU:Q7Z6A9

Regular price €399,95 EUR
Regular price Sale price €399,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Cancer

Uniprot ID: Q7Z6A9

Gene Names: BTLA

Alternative Name(s):

Abbreviation: Recombinant Human BTLA protein, partial (Active)

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 31-157aa

Protein Length: Partial

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYR

MW: 16.1 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human BTLA at 2 μg/mL can bind Anti-BTLA recombinant antibody(CSB-RA773799MAIHU). The EC50 is 11.56-13.00 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Inhibitory receptor on lymphocytes that negatively regulates antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2. May interact in cis (on the same cell) or in trans (on other cells) with TNFRSF14.

Reference: "Point mutations in the BTLA gene in multiple myeloma and other hematologic malignancies." Mao Y., Wang X., Wu H., Chen Y., Ge Y., Chen J., Zhang X. Submitted to EMBL/GenBank/DDBJ databases (APR-2004) "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Gibbs R.A. Nature 440: 1194-1198 (2006) "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Sugano S. Nat. Genet. 36: 40-45 (2004)

Function:

View full details