Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human astrovirus-8 Non-structural polyprotein 1A(ORF1)

Recombinant Human astrovirus-8 Non-structural polyprotein 1A(ORF1)

SKU:CSB-CF888264HGAE

Regular price €1.531,95 EUR
Regular price Sale price €1.531,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Human astrovirus-8 (HAstV-8)

Uniprot NO.:Q9IFX3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:KKKGKTKHGRGRVRRNLRKGVKLLTEEEYRELLEKGLDRETFLDLIDRIIGERSGYPDYD DEDYYDEDDDGWGMVGDDVEFDYTEVINFDQAKPTPAPRTTKPKPCPEPKIEAQPLDLSQ KKEKQPEHEQQVAKPTKPQKIEPQPYSQTYGKAPIWESYDFDWDEDDAKFILPAPHRLTK ADEIVLGSKIVKLRTIIETAIKTQNYSALPEAVFELDKAAYEAGLEGFLQRVKSKNKAPK NYKGPQKTKGPKTTTH

Protein Names:Recommended name: Non-structural polyprotein 1A Cleaved into the following 4 chains: 1. Protein p19 2. Transmembrane protein 1A 3. Serine protease p27 Short name= 4. p27 EC= 5. 3.4.21.- 6. Protein p20'

Gene Names:Name:ORF1

Expression Region:666-921

Sequence Info:full length protein

View full details