Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Apoptosis regulatory protein Siva(SIVA1)

Recombinant Human Apoptosis regulatory protein Siva(SIVA1)

SKU:CSB-YP021347HU

Regular price €753,95 EUR
Regular price Sale price €753,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Cell Biology

Uniprot ID: O15304

Gene Names: SIVA1

Organism: Homo sapiens (Human)

AA Sequence: MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET

Expression Region: 1-110aa

Sequence Info: Full Length of isoform 2

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 13.8 kDa

Alternative Name(s): CD27-binding protein ;CD27BP

Relevance: Induces CD27-mediated apoptosis. Inhibits BCL2L1 isoform Bcl-x(L) anti-apoptotic activity. Inhibits activation of NF-kappa-B and promotes T-cell receptor-mediated apoptosis.

Reference: CD27, a member of the tumor necrosis factor receptor family, induces apoptosis and binds to Siva, a proapoptotic protein.Prasad K.V.S., Ao Z., Yoon Y., Wu M.X., Rizk M., Jacquot S., Schlossman S.F.Proc. Natl. Acad. Sci. U.S.A. 94:6346-6351(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details