
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Cardiovascular
Uniprot ID: P04114
Gene Names: APOB
Organism: Homo sapiens (Human)
AA Sequence: EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS
Expression Region: 28-127aa
Sequence Info: Partial
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 13.2 kDa
Alternative Name(s): Apolipoprotein B-48 Short name: Apo B-48
Relevance: Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.
Reference: "Complete cDNA and derived protein sequence of human apolipoprotein B-100."Knott T.C., Wallis S.C., Powell L.M., Pease R.J., Lusis A.J., Blackhart B., McCarthy B.J., Mahley R.W., Levy-Wilson B., Scott J.Nucleic Acids Res. 14:7501-7503(1986)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
APOB Antibody, Biotin conjugated - Cat. #: CSB-PA001918LD01HU
- Regular price
- €322,95 EUR
- Sale price
- €322,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
APOB antibody , Cat. # FNab00491
- Regular price
- €375,95 EUR
- Sale price
- €375,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Apolipoprotein B
- Regular price
- €578,95 EUR
- Sale price
- €578,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
APOB Antibody - Cat. #: CSB-PA001918LA01HU
- Regular price
- €322,95 EUR
- Sale price
- €322,95 EUR
- Regular price
-
- Unit price
- per
Sold out