Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Androgen-dependent TFPI-regulating protein(ADTRP)

Recombinant Human Androgen-dependent TFPI-regulating protein(ADTRP)

SKU:CSB-CF846640HUb1

Regular price €1.046,95 EUR
Regular price Sale price €1.046,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 10ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 15-20 working days

Research Topic: Others

Uniprot ID: Q96IZ2

Gene Names: ADTRP

Organism: Homo sapiens (Human)

AA Sequence: MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK

Expression Region: 1-230aa

Sequence Info: Full Length

Source: in vitro E.coli expression system

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 31.8 kDa

Alternative Name(s): C6orf105

Relevance: Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells

Reference: "Associations between the CDKN2A/B, ADTRP and PDGFD polymorphisms and the development of coronary atherosclerosis in Japanese patients." Dechamethakun S., Ikeda S., Arai T., Sato N., Sawabe M., Muramatsu M. J. Atheroscler. Thromb. 21:680-690(2014)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details