Gene Bio Systems
Recombinant Human Amphiregulin(AREG)
Recombinant Human Amphiregulin(AREG)
SKU:CSB-CF001986HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:P15514
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECK YIEHLEAVTCKCQQEYFGERCGEK
Protein Names:Recommended name: Amphiregulin Short name= AR Alternative name(s): Colorectum cell-derived growth factor Short name= CRDGF
Gene Names:Name:AREG Synonyms:SDGF ANDName: AREGB
Expression Region:101-184
Sequence Info:Full length protein
