Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Amelogenin, Y isoform (AMELY), partial

Recombinant Human Amelogenin, Y isoform (AMELY), partial

SKU:Q99218

Regular price €673,95 EUR
Regular price Sale price €673,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q99218

Gene Names: AMELY

Alternative Name(s):

Abbreviation: Recombinant Human AMELY protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 17-102aa

Protein Length: Partial

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: MPLPPHPGHPGYINFSYENSHSQAINVDRIALVLTPLKWYQSMIRPPYSSYGYEPMGGWLHHQIIPVVSQQHPLTHTLQSHHHIPV

MW: 17.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Plays a role in biomineralization. Seems to regulate the formation of crystallites during the secretory stage of tooth enamel development. Thought to play a major role in the structural organization and mineralization of developing enamel.

Reference: "Structural variation on the short arm of the human Y chromosome: recurrent multigene deletions encompassing Amelogenin Y." Jobling M.A., Lo I.C., Turner D.J., Bowden G.R., Lee A.C., Xue Y., Carvalho-Silva D., Hurles M.E., Adams S.M., Chang Y.M., Kraaijenbrink T., Henke J., Guanti G., McKeown B., van Oorschot R.A., Mitchell R.J., de Knijff P., Tyler-Smith C., Parkin E.J. Hum Mol Genet 16: 307-316(2007)

Function:

View full details