Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Alpha-synuclein(SNCA)

Recombinant Human Alpha-synuclein(SNCA)

SKU:CSB-EP021912HU

Regular price €606,95 EUR
Regular price Sale price €606,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Neuroscience

Uniprot ID: P37840

Gene Names: SNCA

Organism: Homo sapiens (Human)

AA Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Expression Region: 1-140aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 18.5 kDa

Alternative Name(s): Non-A beta component of AD amyloidNon-A4 component of amyloid precursor ;NACP

Relevance: May be involved in the regulation of dopamine release and transport. Induces fibrillization of microtubule-associated protein tau. Reduces neuronal responsiveness to various apoptotic stimuli, leading to a decreased caspase-3 activation.

Reference: Molecular cloning of cDNA encoding an unrecognized component of amyloid in Alzheimer disease.Ueda K., Fukushima H., Masliah E., Xia Y., Iwai A., Yoshimoto M., Otero D.A., Kondo J., Ihara Y., Saitoh T.Proc. Natl. Acad. Sci. U.S.A. 90:11282-11286(1993)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details