Gene Bio Systems
Recombinant Human ADP-ribosylation factor-like protein 6-interacting protein 6(ARL6IP6)
Recombinant Human ADP-ribosylation factor-like protein 6-interacting protein 6(ARL6IP6)
SKU:CSB-CF850817HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q8N6S5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSFAESGWRSALRRRGPGTPGPVARPSYSSFTQGDSWGEGEVDEEEGCDQVARDLRAEFS AGAWSEPRKRSVLPPDGNGSPVLPDKRNGIFPAAAGSRAQPRRWPVQVLSILCSLLFAIL LAFLLAIAYLIVKELHAENLKNEDDVDTGLLGFWTLLIISLTAGFSCCSFSWTVTYFDSF EPGMFPPTPLSPARFKKLTGHSFHMGYSMAILNGIVAALTVAWCLM
Protein Names:Recommended name: ADP-ribosylation factor-like protein 6-interacting protein 6 Short name= ARL-6-interacting protein 6 Short name= Aip-6 Alternative name(s): Phosphonoformate immuno-associated protein 1
Gene Names:Name:ARL6IP6 Synonyms:PFAAP1
Expression Region:1-226
Sequence Info:full length protein
