Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Acetylcholine receptor subunit alpha(CHRNA1),partial

Recombinant Human Acetylcholine receptor subunit alpha(CHRNA1),partial

SKU:CSB-EP005386HUc2

Regular price €680,95 EUR
Regular price Sale price €680,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Neuroscience

Uniprot ID: P02708

Gene Names: CHRNA1

Organism: Homo sapiens (Human)

AA Sequence: SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL

Expression Region: 21-255aa

Sequence Info: Extracellular Domain

Source: E.coli

Tag Info: N-terminal 6xHis-Trx-tagged

MW: 44.1 kDa

Alternative Name(s):

Relevance: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

Reference: "The human medulloblastoma cell line TE671 expresses a muscle-like acetylcholine receptor. Cloning of the alpha-subunit cDNA." Schoepfer R., Luther M., Lindstrom J.M. FEBS Lett. 226:235-240(1988)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details