Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human 60S ribosomal protein L10a(RPL10A),partial

Recombinant Human 60S ribosomal protein L10a(RPL10A),partial

SKU:CSB-RP052444h

Regular price €606,95 EUR
Regular price Sale price €606,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Epigenetics and Nuclear Signaling

Uniprot ID: P62906

Gene Names: RPL10A

Organism: Homo sapiens (Human)

AA Sequence: KVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSVCVLGDQQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKKNWQNVRALYIKSTMGKPQR

Expression Region: 4-215aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 51.2 kDa

Alternative Name(s): CSA-19Neural precursor cell expressed developmentally down-regulated protein 6 ;NEDD-6

Relevance:

Reference: Identification of genes downregulated in the thymus by cyclosporin-A preliminary characterization of clone CSA-19.Fisicaro N., Katerelos M., Williams J., Power D., D'Apice A., Pearse M.Mol. Immunol. 32:565-572(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details