Skip to product information
1 of 1

Gene Bio Systems

Recombinant Horse Cytochrome b5(CYB5A)

Recombinant Horse Cytochrome b5(CYB5A)

SKU:CSB-CF006309HO

Regular price €1.414,95 EUR
Regular price Sale price €1.414,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Equus caballus (Horse)

Uniprot NO.:P00170

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AEQSDKAVKYYTLEEIKKHNHSKSTWLILHHKVYDLTKFLEDHPGGEEVLREQAGGDATE NFEDIGHSTDARELSKTFIIGELHPDDRSKIAKPVETLITTVDSNSSWWTNWVIPAISAV VVALMYRIYTAED

Protein Names:Recommended name: Cytochrome b5

Gene Names:Name:CYB5A Synonyms:CYB5

Expression Region:2-134

Sequence Info:Full length protein

View full details