Gene Bio Systems
Recombinant Holin-like protein CidA 1(cidA1)
Recombinant Holin-like protein CidA 1(cidA1)
SKU:CSB-CF769113BQE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus anthracis
Uniprot NO.:Q81Y27
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKWWKLSGQILLLFCFAWTGEWIAKQAHLPIPGSIIGIFLLLISLKFNLVKKEWIQDGAD FLLKELILFFIPSAVAVIRYKDTLSQYGIDLILIIMISTLCVTLVTGLLTELLLKRKGSV Q
Protein Names:Recommended name: Holin-like protein CidA 1
Gene Names:Name:cidA1 Ordered Locus Names:BA_3730, GBAA_3730, BAS3458
Expression Region:1-121
Sequence Info:full length protein
