Skip to product information
1 of 1

Gene Bio Systems

Recombinant Hirudo nipponia Guamerin

Recombinant Hirudo nipponia Guamerin

SKU:CSB-YP342406HHK

Regular price €1.122,95 EUR
Regular price Sale price €1.122,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P46443

Gene Names: N/A

Organism: Hirudo nipponia (Korean blood-sucking leech)

AA Sequence: VDENAEDTHGLCGEKTCSPAQVCLNNECACTAIRCMIFCPNGFKVDENGCEYPCTCA

Expression Region: 1-57aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 8.1 kDa

Alternative Name(s):

Relevance: Inhibits mammalian elastases.

Reference: "Isolation and characterization of guamerin, a new human leukocyte elastase inhibitor from Hirudo nipponia."Jung H.I., Kim S.I., Ha K.-S., Joe C.O., Kang K.W.J. Biol. Chem. 270:13879-13884(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details