Skip to product information
1 of 1

Gene Bio Systems

Recombinant Heterodontus francisci Myelin protein P0(mpz)

Recombinant Heterodontus francisci Myelin protein P0(mpz)

SKU:CSB-CF014774HGM

Regular price €1.499,95 EUR
Regular price Sale price €1.499,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Heterodontus francisci (Horn shark) (Cestracion francisci)

Uniprot NO.:P20938

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ISVSTHHNLHKTVGSDVTLYCGFWSNEYVSDLTTLSWRFRPDNSRDIISIFHYGNGVPYIEKWGQFRGRVEWVGDISKHDGSIVIRNLDYIDNGTFTCDVKNPPDVVGTSSDVHLTVYDKIPPVGAGVVSGAIIGTFLGIILLIVGGLYLFRYIVRRRARSETSFLQRRRSAAERGKVSGKAGTVSKGPVLYATLDQSKSGKGASEKKSKLSESKRDKK

Protein Names:Recommended name: Myelin protein P0 Alternative name(s): Myelin peripheral protein Short name= MPP Myelin protein zero

Gene Names:Name:mpz

Expression Region:28-246

Sequence Info:full length protein

View full details