Skip to product information
1 of 1

Gene Bio Systems

Recombinant Hepatitis C virus Genome polyprotein

Recombinant Hepatitis C virus Genome polyprotein

SKU:CSB-CF340929HEX

Regular price €1.259,95 EUR
Regular price Sale price €1.259,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Hepatitis C virus (isolate HC-J2) (HCV)

Uniprot NO.:P27959

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:TTHVTGGATGHTTSGIASLFLPGASQKIQLINTNGSWHINRTALNCNDSLNTGFLAALFY THKFNASGCPERLASCRSIDGFDQGWGPITYTEPGDSDQKPYCWHYAPQRCSVVSAADVC GPVYCFTPSP

Protein Names:Recommended name: Genome polyprotein Cleaved into the following 4 chains: 1. Core protein p21 Alternative name(s): Capsid protein C p21 Core protein p19 Envelope glycoprotein E1 Alternative name(s): gp32 gp35 Envelope g

Gene Names:

Expression Region:384-513

Sequence Info:full length protein

View full details