Skip to product information
1 of 1

Gene Bio Systems

Recombinant Heme transporter hrg-5(hrg-5)

Recombinant Heme transporter hrg-5(hrg-5)

SKU:CSB-CF770331CXY

Regular price €1.443,95 EUR
Regular price Sale price €1.443,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Caenorhabditis elegans

Uniprot NO.:Q7YTM8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSKISSSRCCTLFCHVNTRIALTILDILIGFSNILSYAIQFHNWSALTLTAMVTLVACH TLQMFLAEKKNTITHWKYSTFKWIMWIDITLGFLALGCFVVCFIIAGVTEIEFTNLYGEN LWFTGLWATAITKYTWQNALLARNYSNQKRILKSEIVEDA

Protein Names:Recommended name: Heme transporter hrg-5 Alternative name(s): Heme-responsive gene 5 protein Short name= CeHRG-5

Gene Names:Name:hrg-5 ORF Names:F36H1.9

Expression Region:1-160

Sequence Info:full length protein

View full details