Gene Bio Systems
Recombinant Heliothis zea nuclear polyhedrosis virus Occlusion-derived virus envelope protein E56(odv-e56)
Recombinant Heliothis zea nuclear polyhedrosis virus Occlusion-derived virus envelope protein E56(odv-e56)
SKU:CSB-CF519250HVG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Heliothis zea nuclear polyhedrosis virus (HzSNPV) (Helicoverpa zea single nucleocapsid nuclear polyhedrosis virus)
Uniprot NO.:O10620
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ALRRTGGSYYHIGLNGGEQVESCLLRYRTCVLDVNNLNDVNVCPSDPLIDNINALQSVCH GYNAEVERTVCRRSDPNADPLSLQYVDISPLATGHTISCIEPYDFGDLIGDLGLDGLLGE EGLLNKSSDKSSTSFQKLLPIIVVLGIVLLIIFIGYIVIKRMLMQPPPPPANYNR
Protein Names:Recommended name: Occlusion-derived virus envelope protein E56 Short name= ODV-E56 Alternative name(s): ODVP-6E
Gene Names:Name:odv-e56
Expression Region:1-175
Sequence Info:full length protein
