Skip to product information
1 of 1

Gene Bio Systems

Recombinant Heliothis virescens ascovirus 3e Uncharacterized protein ORF58 (ORF58)

Recombinant Heliothis virescens ascovirus 3e Uncharacterized protein ORF58 (ORF58)

SKU:CSB-CF391368HSI

Regular price €1.508,95 EUR
Regular price Sale price €1.508,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Heliothis virescens ascovirus 3e (HvAV-3e)

Uniprot NO.:A4KXB3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSLTERIGQTPKAYELANERGPFSVEVYLNPGTSNTYQYVATTRNKFNNTDYDDLPWNYT SGKKVVTATGVVSGGERYVFLLRSEIAQDIQVTMYNTNGGSNPLNNSNVTRSNVDSSSYY QQPPQVVYNNGDLYGSRTGYSGAELGASIDKGIASLWGYLKQPLVMVGIAAVVGYLIYRY YYMSRPIGFGSSGAYDVPLLDTPLLRDSYRLPQSFTRDPLFRNSV

Protein Names:Recommended name: Uncharacterized protein ORF58

Gene Names:ORF Names:ORF58

Expression Region:1-225

Sequence Info:full length protein

View full details