Skip to product information
1 of 1

Gene Bio Systems

Recombinant Helicosporidium sp. subsp. Simulium jonesii Probable sulfate transport system permease protein cysT(cysT)

Recombinant Helicosporidium sp. subsp. Simulium jonesii Probable sulfate transport system permease protein cysT(cysT)

SKU:CSB-CF642847HAAW

Regular price €1.559,95 EUR
Regular price Sale price €1.559,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Helicosporidium sp. subsp. Simulium jonesii (Green alga)

Uniprot NO.:Q2EEX6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGNFILHPIQSRLIVISYSILILILPLYALFSYASNASWSLILEKATDPIAVAAYTLTIK MALYTAIINTIFGFIIAWVLTRYNFSGKRIMDAIVDLPLALPTSVAGLALSTVFGRNGLF GHILDFYNYEIIYTKRGILLAMIFVSFPFSVRAIQPILKEINKEEEEAAWSLGSGPLETF KRFIFPIILPAILNGFTLTFSRSLSEFGSIVMVAGNLPLQDLVSSVLISQYLEQYDYIGA CVISIIVLMLACSVLLFVQIIHSLVVVDSK

Protein Names:Recommended name: Probable sulfate transport system permease protein cysT

Gene Names:Name:cysT

Expression Region:1-270

Sequence Info:full length protein

View full details