Gene Bio Systems
Recombinant Helicobacter pylori Uncharacterized protein HP_1330 (HP_1330)
Recombinant Helicobacter pylori Uncharacterized protein HP_1330 (HP_1330)
SKU:CSB-CF522895HUV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Uniprot NO.:O25888
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLMHSILIILVIILTTYFTRIWPFMVFNAKNPPNDFVRYLGRALSCSVIGMLVIYCFKDI HILKPPYGINEITAFLSVILLHRIFKVFVLSITLPTILYMVLVQSHALEKAFFNP
Protein Names:Recommended name: Uncharacterized protein HP_1330
Gene Names:Ordered Locus Names:HP_1330
Expression Region:1-115
Sequence Info:full length protein
