Skip to product information
1 of 1

Gene Bio Systems

Recombinant Helicobacter pylori Cbb3-type cytochrome c oxidase subunit CcoP(ccoP)

Recombinant Helicobacter pylori Cbb3-type cytochrome c oxidase subunit CcoP(ccoP)

SKU:CSB-CF510607HUU

Regular price €1.568,95 EUR
Regular price Sale price €1.568,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Helicobacter pylori (strain 52)

Uniprot NO.:D0K261

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDFLNDHINVFGLIAALVILVLTIYESSSLIKEMRDSKSQGELMENGHLIDGIGEFANNV PVGWIASFMCTIVWAFWYFFFGYPLNSFSQIGQYNEEVKAHNQKFEAKWKNLGQKELVDM GQGIFLVHCSQCHGITAEGLHGSAQNLVRWGKEEGIMDTIKHGSKGMDYLAGEMPAMELD EKDAKAIASYVMAEISSVKKTKNPQLIDKGKELFESMGCTGCHGNDGKGLQENQVFAADL TAYGTENFLRNILTHGKKGNIGHMPSFKYKNFSDLQVKALAEFIQSLKPLED

Protein Names:Recommended name: Cbb3-type cytochrome c oxidase subunit CcoP Short name= Cbb3-Cox subunit CcoP Alternative name(s): C-type cytochrome CcoP Short name= Cyt c(P) Cytochrome c oxidase subunit III

Gene Names:Name:ccoP Ordered Locus Names:HPKB_0155

Expression Region:1-292

Sequence Info:full length protein

View full details