Gene Bio Systems
Recombinant Helicobacter pylori ATP synthase subunit b(atpF)
Recombinant Helicobacter pylori ATP synthase subunit b(atpF)
SKU:CSB-CF002358HUZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Helicobacter pylori (strain Shi470)
Uniprot NO.:B2UUP4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFLVKMVLGFLIFLSPLCATGLDISQTDIIERSLNFLLFAGILWYFLAKKLRSFLHSKSLEISKRLEEIQAQLKVSKENKKKLLKELEQAKEKAELIISDANKEAYTITQKYELQTKMDVENLIKNSKALMDLEVKKIKRELVESVFKDLRESKKVSFNVQDCVNILKQRL
Protein Names:Recommended name: ATP synthase subunit b Alternative name(s): ATP synthase F(0) sector subunit b ATPase subunit I F-type ATPase subunit b Short name= F-ATPase subunit b
Gene Names:Name:atpF Ordered Locus Names:HPSH_05850
Expression Region:1-171
Sequence Info:full length protein
