Skip to product information
1 of 1

Gene Bio Systems

Recombinant Halorubrum lacusprofundi UPF0290 protein Hlac_0350 (Hlac_0350)

Recombinant Halorubrum lacusprofundi UPF0290 protein Hlac_0350 (Hlac_0350)

SKU:CSB-CF498606HUB

Regular price €1.467,95 EUR
Regular price Sale price €1.467,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34)

Uniprot NO.:B9LSA9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIGSLVATAFWAMLPAYVPNNAAVLAGGGRPIDGGRDWRGARLLGDGKTWRGTAVGTLTG VVLALALNRIAEPASAALGVDLPTFALPAAFALAFGAMCGDIGASFLKRRSGRERGAAFP GLDQLDFVVVALAAVFVVDTDWALAVFTPSVLVVVLVMTPILHVVTNVGAYALGLKNEPW

Protein Names:Recommended name: UPF0290 protein Hlac_0350

Gene Names:Ordered Locus Names:Hlac_0350

Expression Region:1-180

Sequence Info:full length protein

View full details