Skip to product information
1 of 1

Gene Bio Systems

Recombinant Haliotis laevigata Perlwapin

Recombinant Haliotis laevigata Perlwapin

SKU:CSB-EP306283HAZ

Regular price €1.022,95 EUR
Regular price Sale price €1.022,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P84811

Gene Names: N/A

Organism: Haliotis laevigata (Smooth Australian abalone)

AA Sequence: YGPNLPGCPPGPYPRICARYCHSDRECKAGYYCCNTGCLNICVPKPKPGLCPAIRPGPCKGNVCSNDQDCPGNQKCCGKPGCRRCYRPEKPGSCPPRKYDAGVCVIYCVGDFDCPGNEKCCGSCPRRCEKPCFD

Expression Region: 1-134aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 19.5 kDa

Alternative Name(s):

Relevance: Inhibits growth of calcium carbonate crystals. May inhibit growth of certain crystallographic planes in the mineral phase of nacre in the shell.

Reference: "Perlwapin, an abalone nacre protein with three four-disulfide core (whey acidic protein) domains, inhibits the growth of calcium carbonate crystals."Treccani L., Mann K., Heinemann F., Fritz M.Biophys. J. 91:2601-2608(2006)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details