Skip to product information
1 of 1

Gene Bio Systems

Recombinant Hahella chejuensis UPF0060 membrane protein HCH_03337(HCH_03337)

Recombinant Hahella chejuensis UPF0060 membrane protein HCH_03337(HCH_03337)

SKU:CSB-CF651802HAAI

Regular price €1.401,95 EUR
Regular price Sale price €1.401,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Hahella chejuensis (strain KCTC 2396)

Uniprot NO.:Q2SGY2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MALLKITLLFAVTAITEIVGCYLPWLVIKQGKSLWLLVPAALSLAIFAWLLTLHPTAAGR TYAAYGGMYVVVALIWLHFVEGVGLTRFDFLGATMALAGMAIIALQPISHS

Protein Names:Recommended name: UPF0060 membrane protein HCH_03337

Gene Names:Ordered Locus Names:HCH_03337

Expression Region:1-111

Sequence Info:full length protein

View full details