
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Haemophilus somnus (strain 129Pt) (Histophilus somni (strain 129Pt))
Uniprot NO.:Q0I185
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSFIKEFREFAMRGNVIDMAVGVIIGGAFGKIVSSLVADVIMPILSFFTSSVDFKDLHIV LKEATDKTPAMTLKYGMFIQNIFDFIIIAFAIFLMIKALNKLKKEEPKVEKVITPSNEEK LLTEIRDLLKK
Protein Names:Recommended name: Large-conductance mechanosensitive channel
Gene Names:Name:mscL Ordered Locus Names:HS_0037
Expression Region:1-131
Sequence Info:full length protein
You may also like
-
Recombinant Haemophilus somnus Large-conductance mechanosensitive channel(mscL)
- Regular price
- €1.033,95 EUR
- Sale price
- €1.033,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Haemophilus influenzae Large-conductance mechanosensitive channel(mscL)
- Regular price
- €1.031,95 EUR
- Sale price
- €1.031,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Haemophilus influenzae Large-conductance mechanosensitive channel(mscL)
- Regular price
- €1.031,95 EUR
- Sale price
- €1.031,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Haemophilus ducreyi Large-conductance mechanosensitive channel(mscL)
- Regular price
- €1.035,95 EUR
- Sale price
- €1.035,95 EUR
- Regular price
-
- Unit price
- per
Sold out