Gene Bio Systems
Recombinant Haemophilus influenzae UPF0299 membrane protein CGSHiEE_04225 (CGSHiEE_04225)
Recombinant Haemophilus influenzae UPF0299 membrane protein CGSHiEE_04225 (CGSHiEE_04225)
SKU:CSB-CF403764HSD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Haemophilus influenzae (strain PittEE)
Uniprot NO.:A5UBU9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIQKLFLLVRSLVILSIMLSLGNLIAYYIPSGVPGSIWGLLLLFLGLTTRVIHLNWIYLG ASLLIRFMAVLFVPVSVGIIKYSDLLIEQINILLVPNIVSTCVTLLVIGFLGHYLYQMQS FTHKRKKVIKRKRKSGKTSQLVC
Protein Names:Recommended name: UPF0299 membrane protein CGSHiEE_04225
Gene Names:Ordered Locus Names:CGSHiEE_04225
Expression Region:1-143
Sequence Info:full length protein
