Skip to product information
1 of 1

Gene Bio Systems

Recombinant Haemophilus influenzae Uncharacterized protein HI_1595 (HI_1595)

Recombinant Haemophilus influenzae Uncharacterized protein HI_1595 (HI_1595)

SKU:CSB-CF337727HTA

Regular price €1.380,95 EUR
Regular price Sale price €1.380,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Uniprot NO.:P44266

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIKQITERFTPRQYLAEFLLGLTALFGLYLIVAWSSYTPLDNSWATVSAYGNTINKVGSF GAWIIDLFFVFLGYVAHIIPFTAFLVPIYLLKTKAVKQLSCTRIILR

Protein Names:Recommended name: Uncharacterized protein HI_1595

Gene Names:Ordered Locus Names:HI_1595

Expression Region:1-107

Sequence Info:full length protein

View full details