Skip to product information
1 of 1

Gene Bio Systems

Recombinant Haemophilus influenzae Phosphatidylglycerophosphatase A(pgpA)

Recombinant Haemophilus influenzae Phosphatidylglycerophosphatase A(pgpA)

SKU:CSB-CF337677HTA

Regular price €1.446,95 EUR
Regular price Sale price €1.446,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Uniprot NO.:P44157

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTENNPLKKISLLNPIHLLAVGFGSGLIHPAPGTWGSLAGTILGVILLSLLGVKIFLIFT ALCFLLGCYLCQKTTADMGVHDHGSIVWDEFVGVFIVLAAIPSLSWQWILAAFALFRFFD ILKPFPIRYFDEKLENGFGIMIDDVLAAIYAVIVVFAIQYWML

Protein Names:Recommended name: Phosphatidylglycerophosphatase A EC= 3.1.3.27

Gene Names:Name:pgpA Ordered Locus Names:HI_1306

Expression Region:1-163

Sequence Info:full length protein

View full details