Skip to product information
1 of 1

Gene Bio Systems

Recombinant Grapevine leafroll-associated virus 3 Protein P7 (ORF12)

Recombinant Grapevine leafroll-associated virus 3 Protein P7 (ORF12)

SKU:CSB-CF526674GHC

Regular price €1.341,95 EUR
Regular price Sale price €1.341,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Grapevine leafroll-associated virus 3 (isolate United States/NY1) (GLRaV-3) (Grapevine leafroll-associated closterovirus (isolate 109))

Uniprot NO.:O71197

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRHLEKPIRVAVHYCVVRSDVCDGWDVFIGVTLIGMFISYYLYALISICRKGEGLTTSNG

Protein Names:Recommended name: Protein P7 Alternative name(s): 7 kDa protein

Gene Names:ORF Names:ORF12

Expression Region:1-60

Sequence Info:full length protein

View full details