Skip to product information
1 of 1

Gene Bio Systems

Recombinant Gracilaria tenuistipitata var. liui Uncharacterized tatC-like protein ycf43(ycf43)

Recombinant Gracilaria tenuistipitata var. liui Uncharacterized tatC-like protein ycf43(ycf43)

SKU:CSB-CF718365GBAK

Regular price €1.513,95 EUR
Regular price Sale price €1.513,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Gracilaria tenuistipitata var. liui (Red alga)

Uniprot NO.:Q6B8S9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNRNINFNTEMSIFEHLEELRQRIFIAALIFIVITAICFTYMKNISYILQQPAIGIKFLQ LAPGEYLFTSIKVALYSGFLLSSPFIIYQITLFILPGLTKKESNFIVPILFISIILFFSG IVFAYIILVPAALKFLINYGNEIVEPIWSFEQYFNFILLLLFSTGIAFQIPIIQVILGIL KIFSSSEMYAYWKYIVLGATVIAAIITPSTDPITQIIMSIAILALYSSGIIILKILNK

Protein Names:Recommended name: Uncharacterized tatC-like protein ycf43

Gene Names:Name:ycf43 Ordered Locus Names:Grc000125

Expression Region:1-238

Sequence Info:full length protein

View full details